missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101475

Invitrogen™ Human TEAD4 (aa 139-202) Control Fragment Recombinant Protein

Catalog No. RP101475
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101475 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101475 Supplier Invitrogen™ Supplier No. RP101475

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Specifications

Accession Number Q15561
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7004
Name Human TEAD4 (aa 139-202) Control Fragment
Quantity 100 μL
Gene Alias EFTR-2; Etfr2; ETFR-2; ETF-related factor 2; ETF-related factor-2; FGF-regulated 19; FR-19; hRTEF-1 B; related transcription enhancer factor 1 B; RTEF1; RTEF-1; TCF13L1; Tcf13r1; TEA domain family member 4; TEA domain transcription factor 4; TEAD4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; TEF3; TEF-3; Tefr; Tefr1; TEFR-1; Tefr1a; Transcription factor 13-like 1; transcription factor RTEF-1; transcriptional enhancer factor 1-related; transcriptional enhancer factor 3; transcriptional enhancer factor TEF-3
Common Name TEAD4
Gene Symbol Tead4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less