missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94005

Invitrogen™ Human TDIF2 (aa 174-272) Control Fragment Recombinant Protein

Catalog No. RP94005
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94005 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94005 Supplier Invitrogen™ Supplier No. RP94005

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is thought to be involved in chromatin remodeling and gene transcription. The encoded nuclear protein binds to and enhances the transcriptional activity of the estrogen receptor alpha, and also interacts with terminal deoxynucleotidyltransferase. The expression profile of this gene is a potential biomarker for chronic obstructive pulmonary disease.

Specifications

Accession Number Q5QJE6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 30836
Name Human TDIF2 (aa 174-272) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4930588M11Rik; AA408582; acidic 82 kDa protein mRNA; AU014960; deoxynucleotidyltransferase terminal interacting protein 2; deoxynucleotidyltransferase terminal-interacting protein 2; deoxynucleotidyltransferase, terminal, interacting protein 2; DNTTIP2; ERBP; estrogen receptor binding protein; Estrogen receptor-binding protein; FCF2; HSU15552; LPTS-interacting protein 2; LPTS-RP2; TDIF2; tdT-interacting factor 2; Terminal deoxynucleotidyltransferase-interacting factor 2
Common Name TDIF2
Gene Symbol DNTTIP2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less