missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94302

Invitrogen™ Human TCTEX1D1 (aa 2-84) Control Fragment Recombinant Protein

Catalog No. RP94302
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94302 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94302 Supplier Invitrogen™ Supplier No. RP94302

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are multi-subunit, high molecular weight ATPases that interact with microtubules to generate force by converting the chemical energy of ATP into the mechanical energy of movement. Cytoplasmic or axonemal Dynein is an approximately 12 subunit complex of two heavy chains, two intermediate chains to anchor Dynein to its cargo, four smaller intermediate chains and several light chains. It performs functions necessary for cell survival such as organelle transport and centrosome assembly. TCTEX1 is a cytoplasmic dynein light chain found in a complex with Na+ CP type X (SCN10A). TCTEX1D1, also called TCTEX1 domain containing 1, belongs to the dynein light chain TCTEX-type family. Its function is still under investigation.

Specifications

Accession Number Q8N7M0
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 200132
Name Human TCTEX1D1 (aa 2-84) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias FLJ40873; MGC125768; Tctex1 domain containing 1; tctex1 domain-containing protein 1; TCTEX1D1
Common Name TCTEX1D1
Gene Symbol TCTEX1D1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less