missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TAPT1 (aa 464-552) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP99894
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60025 (PA5-60025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a highly conserved, putative transmembrane protein. A mutation in the mouse ortholog of this gene results in homeotic, posterior-to-anterior transformations of the axial skeleton which are similar to the phenotype of mouse homeobox C8 gene mutants. This gene is proposed to function downstream of homeobox C8 to transduce extracellular patterning information during axial skeleton development. An alternatively spliced transcript variant encoding a substantially different isoform has been described, but its biological validity has not been determined.Specifications
| Q6NXT6 | |
| Blocking Assay, Control | |
| 202018 | |
| 100 μL | |
| 4932414K18Rik; CMVFR; Cytomegalovirus partial fusion receptor; OCLSBG; TAPT1; transmembrane anterior posterior transformation 1; transmembrane anterior posterior transformation protein 1; Transmembrane anterior posterior transformation protein 1 homolog | |
| TAPT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TAPT1 (aa 464-552) Control Fragment | |
| RUO | |
| TAPT1 | |
| Unconjugated | |
| Recombinant | |
| EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |