missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP103650

Invitrogen™ Human TAF6L (aa 304-384) Control Fragment Recombinant Protein

Catalog No. RP103650
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103650 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103650 Supplier Invitrogen™ Supplier No. RP103650
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64316 (PA5-64316. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In eukaryotic systems, the process of initiating transcription from protein-coding genes requires the presence of RNA polymerase II and a broad family of auxiliary transcription factors. TFIID is a general transcription factor that initiates preinitiation complex assembly through direct interaction with the TATA promoter element. Functioning as a multisubunit complex consisting of a small TATA-binding polypeptide and other TBP-associated factors (TAFs), TFIID mediates promoter responses to various transcriptional activators and repressors. TAF6L, also known as PAF65A, is a 622 amino acid nuclear protein that functions as part of the PCAF (p300/CBP-associated factor) histone acetylase complex.

Specifications

Accession Number Q9Y6J9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10629
Name Human TAF6L (aa 304-384) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810417N14Rik; BB223262; C530024J06Rik; fa05b10; p300/CBP-associated factor (PCAF)-associated factor 65; Paf65a; PAF65-alpha; PCAF-associated factor 65 alpha; PCAF-associated factor 65-alpha; TAF6L; TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6 L; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65 kDa; TATA box binding protein associated factor 6 like; TATA-box binding protein associated factor 6 like; wu:fa05b10
Common Name TAF6L
Gene Symbol TAF6L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less