missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TACC3 (aa 182-291) Control Fragment Recombinant Protein

Catalog No. RP88724
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88724 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88724 Supplier Invitrogen™ Supplier No. RP88724

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54560 (PA5-54560. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TACC1 is located on 8p11 chromosomal region that is amplified in approximately 15% of all breast tumor samples. The short arm of chromosome 8 also contains FGFR1 whose expression is enhanced in most breast cancer tumors. TACC family members, TACC1, TACC2, and TACC3, map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 4,8, and 10. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. Also, TACC1 contains a conserved C-terminal region as in the Drosophila homolog, D-TACC. It has been shown that D-TACC is necessary for normal spindle function, and the mammalian TACC proteins appears to interact with centrosomes and microtubules in a similar manner.

Specifications

Accession Number Q9Y6A5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10460
Name Human TACC3 (aa 182-291) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Aint; Arnt interacting protein; ARNT-interacting protein; C86661; ERIC1; ERIC-1; Tacc3; transforming acidic coiled coil 3; transforming acidic coiled-coil containing protein 3; transforming acidic coiled-coil-containing protein 3; transforming, acidic coiled-coil containing protein 3
Common Name TACC3
Gene Symbol TACC3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less