missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88909

Invitrogen™ Human SYNJ2BP (aa 2-113) Control Fragment Recombinant Protein

Catalog No. RP88909
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88909 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88909 Supplier Invitrogen™ Supplier No. RP88909
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51471 (PA5-51471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.

Specifications

Accession Number P57105
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55333
Name Human SYNJ2BP (aa 2-113) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409442; activin receptor interacting protein 2; activin receptor interacting protein 5; activin receptor-interacting protein 2; activin receptor-interacting protein 2 A; activin receptor-interacting protein 4; ActRIP4; Arip2; ARIP2a; D12Wsu118e; Mitochondrial outer membrane protein 25; NPW16; Omp25; outer membrane protein; outer membrane protein 25; synaptojanin 2 binding protein; synaptojanin-2-binding protein; SYNJ2BP
Common Name SYNJ2BP
Gene Symbol SYNJ2BP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less