missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Survivin (aa 1-128) Control Fragment Recombinant Protein

Catalog No. RP101903
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101903 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101903 Supplier Invitrogen™ Supplier No. RP101903
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110659 (PA5-110659. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Survivin (IAP4) is the smallest member of the Inhibitors of Apoptosis Protein (IAP) gene family. The IAPs are involved in multiple cell functions such as cell signaling, cell division, metabolism, and exhibits differential expression in nearly all human cancers, but not in most normal tissues. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but the Survivin gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of survivin’s gene expression. Survivin is expressed in the G2/M phase of the cell cycle in a cycle-regulated manner. At the beginning of mitosis, survivin associates with microtubules of the mitotic spindle in a specific and saturable reaction that is regulated by microtubule dynamics. Disruption of survivin-microtubule interactions results in loss of survivin's anti-apoptosis function and increased caspase-3 activity, a mechanism involved in cell death, during mitosis. Survivin may counteract a default induction of apoptosis in G2/M phase. Survivin is also abundantly expressed in brain tissues (astrocytes and some neurons) of adult rats following traumatic brain injury. Survivin has been found co-expressed with NeuN (mature neuronal marker) and PCNA (a cell cycle protein). Survivin might affect regulation of neural cell proliferative responses after brain injury. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined. The overexpression of survivin in cancer may overcome this apoptotic checkpoint and favor aberrant progression of transformed cells through mitosis.

Specifications

Accession Number O15392
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 332
Name Human Survivin (aa 1-128) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AAC-11; AP14; Api4; apoptosis inhibitor 4; Apoptosis inhibitor survivin; baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing 5; baculoviral IAP repeat-containing 5 (survivin); baculoviral IAP repeat-containing protein 5; BIRC 5; BIRC5; EPR 1; EPR-1; Iap4; inhibitor of apoptosis; survivin; survivin variant 3 alpha; survivin40; SVV; TIAP
Common Name Survivin
Gene Symbol Birc5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less