missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SULT2B1 (aa 192-269) Control Fragment Recombinant Protein

Catalog No. RP98895
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98895 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98895 Supplier Invitrogen™ Supplier No. RP98895
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59696 (PA5-59696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytosolic sulfotransferases (STs or SULTs) catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. Her et al. (1998) identified an EST with homology to ST enzymes. By PCR with human placental and prostate cDNA as template, they isolated 2 alternatively spliced cDNAs, identical throughout most of their sequences, but having different 5-prime ends. The shorter cDNA, SULT2B1a, encodes a protein of 350 amino acids; the longer cDNA, SULT2B1b, encodes a 365-amino acid protein. Genomic PCR analysis revealed that the gene encoding both cDNAs, SULT2B1, contains 7 exons, with 2 alternative first exons being used to generate SULT2B1a and SULT2B1b. Northern blot analysis revealed that the SULT2B1 gene is expressed as a 1.4-kb transcript predominantly in prostate, placenta, and trachea.

Specifications

Accession Number O00204
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6820
Name Human SULT2B1 (aa 192-269) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI326997; alcohol sulfotransferase; BB173635; HSST2; Hydroxysteroid sulfotransferase 2; RGD:1308882}; ST2B1; sulfotransferase 2 B; sulfotransferase 2B1; Sulfotransferase family 2 B member 1; sulfotransferase family cytosolic 2 B member 1; sulfotransferase family, cytosolic, 2 B, member 1; SULT2B; Sult2b1; sult2b1 {ECO:0000312; SULT2B1a
Common Name SULT2B1
Gene Symbol SULT2B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less