missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98959

Invitrogen™ Human SULT2A1 (aa 169-251) Control Fragment Recombinant Protein

Catalog No. RP98959
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98959 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98959 Supplier Invitrogen™ Supplier No. RP98959
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83561 (PA5-83561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SULT1 sulfotransferases exhibit N-sulfating activities of carcinogenic heterocyclic amines, and are selective toward phenols, whereas SULT2 enzymes prefer hydroxysteroids and SULT3 family members are selective for N-substituted aryl and alicyclic compounds. SULT2A1 catalyzes the sulfonation of procarcinogen xenobiotics, hydroxysteroids and bile acids, and is highly expressed in adrenal and liver tissues. SULT2A1 plays a role in hepatic cholesterol homeostasis. SULT2B1 consists of two isoforms, SULT2B1a and SULT2B1b, which are transcribed from the same gene by alternative splicing of their first exons. Both isoforms are highly selective for the sulphation of 3b-hydroxysteroids such as pregnenolone, epiandrosterone, DHEA and androstenediol. SULT2B1b is expressed in prostate, skin, placenta and lung.

Specifications

Accession Number Q06520
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6822
Name Human SULT2A1 (aa 169-251) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alcohol sulfotransferase; alcohol/hydroxysteroid sulfotransferase; bile salt sulfotransferase; Bile salt sulfotransferase 1; bile-salt sulfotranasferase 2A1; bile-salt sulfotransferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEAS; DHEA-ST; HST; hSTa; Hydroxysteroid sulfotransferase; hydroxysteroid sulfotransferase a; mSTa1; Smp-2; ST; ST2; ST-20; ST2A1; ST2A3; STa; Sta1; Std; Sth1; Sth2; Sulfotransferase 2A1; sulfotransferase family 2 A member 1; sulfotransferase family 2 A, dehydroepiandrosterone (DHEA)-preferring, member 1; sulfotransferase family, cytosolic, 2 A, dehydroepiandrosterone (DHEA) -preferring, member 1; sulfotransferase family, cytosolic, 2 A, dehydroepiandrosterone (DHEA)-preferring, member 1; sulfotransferase hydroxysteroid gene 2; sulfotransferase, DHEA preferring; sulfotransferase, hydroxysteroid preferring 1; sulfotransferase, hydroxysteroid preferring 2; SULT2A1
Common Name SULT2A1
Gene Symbol SULT2A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less