missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SULT1B1 (aa 30-132) Control Fragment Recombinant Protein

Catalog No. RP100985
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100985 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100985 Supplier Invitrogen™ Supplier No. RP100985
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51683 (PA5-51683. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes.

Specifications

Accession Number O43704
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27284
Name Human SULT1B1 (aa 30-132) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DOPA/tyrosine sulfotransferase; ST1B1; ST1B2; St2b2; sulfotransferase 1B1; sulfotransferase 1B2; sulfotransferase family 1 B member 1; sulfotransferase family 1 B, member 1; sulfotransferase family cytosolic 1 B member 1; sulfotransferase family, cytosolic, 1 B, member 1; SULT1B1; SULT1B2; Thyroid hormone sulfotransferase
Common Name SULT1B1
Gene Symbol SULT1B1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less