missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human STS1 (aa 297-370) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109850
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144780 (PA5-144780. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Sts1 encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor.Specifications
| Q8TF42 | |
| Blocking Assay, Control | |
| 84959 | |
| 100 μL | |
| 2810457I06Rik; BB125008; Cbl-interacting protein p70; Cbl-interacting protein Sts-1; KIAA1959; MGC15437; nm23-phosphorylated unknown substrate; p70; RGD1310357; SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate; STS1; STS-1; suppressor of T-cell receptor signaling 1; T-cell ubiquitin ligand 2; TULA2; TULA-2; tyrosine-protein phosphatase STS1/TULA2; UBASH3B; ubiquitin associated and SH3 domain containing B; ubiquitin associated and SH3 domain containing, B; ubiquitin-associated and SH3 domain-containing protein B | |
| UBASH3B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human STS1 (aa 297-370) Control Fragment | |
| RUO | |
| STS1 | |
| Unconjugated | |
| Recombinant | |
| YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |