missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91919

Invitrogen™ Human STS (aa 248-364) Control Fragment Recombinant Protein

Catalog No. RP91919
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91919 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91919 Supplier Invitrogen™ Supplier No. RP91919

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110662 (PA5-110662. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Specifications

Accession Number P08842
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 412
Name Human STS (aa 248-364) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ArsC; ARSC1; Arylsulfatase C; ASC; ES; Estrone sulfatase; LOC402795 protein; LOW QUALITY PROTEIN: steryl-sulfatase; steryl-sulfatase; si:ch211-271l9.1; SSDD; Steroid sulfatase; steroid sulfatase (microsomal), arylsulfatase C, isozyme S; steroid sulfatase (microsomal), isozyme S; steroid sulphatase; steryl-sulfatase; Steryl-sulfate sulfohydrolase; STS; XLI
Common Name STS
Gene Symbol Sts
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less