missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95912

Invitrogen™ Human STK19 (aa 6-74) Control Fragment Recombinant Protein

Catalog No. RP95912
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95912 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95912 Supplier Invitrogen™ Supplier No. RP95912
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56764 (PA5-56764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.

Specifications

Accession Number P49842
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8859
Name Human STK19 (aa 6-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D6S60; D6S60E; G11; HLA-RP1; MHC class III HLA-RP1; nuclear serine/threonine protein kinase; Protein G11; Protein RP1; RP1; serine/threonine kinase 19; serine/threonine-protein kinase 19; Stk19
Common Name STK19
Gene Symbol STK19
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less