missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human STK11IP (aa 826-911) Control Fragment Recombinant Protein

Catalog No. RP96132
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96132 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96132 Supplier Invitrogen™ Supplier No. RP96132

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57842 (PA5-57842. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May regulate STK11/LKB1 function by controlling its subcellular localization.

Specifications

Accession Number Q8N1F8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114790
Name Human STK11IP (aa 826-911) Control Fragment
Quantity 100 μL
Gene Alias 1200014D22Rik; BB131189; KIAA1898; LIP1; LKB1-interacting protein 1; LKB1IP; serine/threonine kinase 11 interacting protein; serine/threonine kinase 11-interacting protein; serine/threonine-protein kinase 11-interacting protein; STK11 interacting protein; STK11IP; STK11IP1
Common Name STK11IP
Gene Symbol STK11IP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MCLVVVSDRRLYLLKVTGEMREPPASWLQLTLAVPLQDLSGIELGLAGQSLRLEWAAGAGRCVLLPRDARHCRAFLEELLDVLQSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less