missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human STARD7 (aa 49-152) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104179
Description
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64193 (PA5-64193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May play a protective role in mucosal tissues by preventing exaggerated allergic responses. [UniProt]Specifications
| Q9NQZ5 | |
| Blocking Assay, Control | |
| 56910 | |
| 100 μL | |
| AI852671; AL022671; AW544915; gestational trophoblastic tumor protein 1; GTT1; StAR related lipid transfer domain containing 7; StARD7; StAR-related lipid transfer (START) domain containing 7; StAR-related lipid transfer domain containing 7; stAR-related lipid transfer protein 7, mitochondrial; START domain containing 7; START domain-containing protein 7 | |
| STARD7 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human STARD7 (aa 49-152) Control Fragment | |
| RUO | |
| STARD7 | |
| Unconjugated | |
| Recombinant | |
| YSESSRRVLLGRLWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |