missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102140

Invitrogen™ Human STAP2 (aa 231-331) Control Fragment Recombinant Protein

Catalog No. RP102140
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102140 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102140 Supplier Invitrogen™ Supplier No. RP102140
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82014 (PA5-82014. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q9UGK3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55620
Name Human STAP2 (aa 231-331) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW049765; BKS; Breast tumor kinase substrate; brk kinase substrate; BRK substrate; FLJ20234; signal transducing adaptor family member 2; signal-transducing adaptor protein 2; signal-transducing adaptor protein-2; STAP2; STAP-2
Common Name STAP2
Gene Symbol STAP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less