missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108947

Invitrogen™ Human ST8SIA2 (aa 29-100) Control Fragment Recombinant Protein

Catalog No. RP108947
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108947 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108947 Supplier Invitrogen™ Supplier No. RP108947

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

Specifications

Accession Number Q92186
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8128
Name Human ST8SIA2 (aa 29-100) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI323367; alpha-2,8-sialyltransferase; alpha-2,8-sialyltransferase 8B; alpha-2,8-sialyltransferase 8B 1; cb394; HsT19690; id:ibd5161; MGC116854; MGC116857; N-glycan alpha 2,8-sialyltransferase; polysialic acid synthase; sialyltransferase 8; sialyltransferase 8 (alpha-2 8-sialytransferase) B; sialyltransferase 8 (alpha-2, 8-sialyltransferase) B; sialyltransferase 8 (alpha-2, 8-sialytransferase) B; sialyltransferase 8B; Sialyltransferase St8Sia II; sialyltransferase X; sialytransferase St8Sia II; SIAT 8B; siat8; SIAT8B; SIAT8-B; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2; ST8Sia II; ST8SIA2; st8sia2 protein; ST8SiaII; ST8SIA-II; STX
Common Name ST8SIA2
Gene Symbol ST8SIA2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less