missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ST6GALNAC6 (aa 60-102) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109825
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145032 (PA5-145032. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.Specifications
| Q969X2 | |
| Blocking Assay, Control | |
| 30815 | |
| 100 μL | |
| (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; alpha-2,6-sialyltransferase ST6GalNAc VI; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; beta-galactosamide alpha-2,6-sialyltransferase; CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI; galNAc alpha-2,6-sialyltransferase VI; Sialyltransferase 7 F; sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialytransferase) F; sialytransferase 7 F; SIAT7F; SIAT7-F; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; ST6 GalNAc alpha-2,6-sialyltransferase 6; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; ST6 -N-acetylgalactosaminide alpha-26-sialyltransferase 6; ST6GalNAc VI; St6galnac6; ST6GalNAcVI; st6GalNAc-VI; UNQ708/PRO1359 | |
| ST6GALNAC6 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ST6GALNAC6 (aa 60-102) Control Fragment | |
| RUO | |
| ST6GALNAC6 | |
| Unconjugated | |
| Recombinant | |
| SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |