missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105461

Invitrogen™ Human ST3GAL5 (aa 236-333) Control Fragment Recombinant Protein

Catalog No. RP105461
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105461 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105461 Supplier Invitrogen™ Supplier No. RP105461

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67026 (PA5-67026. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in this gene has been associated with Amish infantile epilepsy syndrome. Transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number Q9UNP4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8869
Name Human ST3GAL5 (aa 236-333) Control Fragment
Quantity 100 μL
Gene Alias [a]2; 3 S-T; alpha 2,3-sialyltransferase V; alpha2,3-sialyltransferase; CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; Ganglioside GM3 synthase; GM3 synthase; GM3S; GM3-specific sialytransferase; lactosylceramide alpha-2,3-sialyltransferase; lactosylceramide alpha-2,3-sialyltransferas-like protein; mST3Gal V; SATI; Sialyltransferase 9; sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase); sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase; GM3 synthase); Siat9; SIATGM3S; ST3 beta-galactoside alpha-2,3-sialyltransferase 5; ST3 beta-galactoside alpha-23-sialyltransferase 5; ST3Gal V; ST3GAL5; ST3GalV; ST3GAL-V; UNQ2510/PRO5998
Common Name ST3GAL5
Gene Symbol ST3GAL5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less