missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101187

Invitrogen™ Human ST3GAL4 (aa 26-85) Control Fragment Recombinant Protein

Catalog No. RP101187
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101187 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101187 Supplier Invitrogen™ Supplier No. RP101187
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62056 (PA5-62056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synthesis of alpha-2, 3-linked sialic acid to Gal(beta-1, 3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2, 3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2, 6-sialyltransferase, ST6GAL1.

Specifications

Accession Number Q11206
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6484
Name Human ST3GAL4 (aa 26-85) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha 2,3-sialyltransferase IV; Alpha 2,3-ST 4; alpha-2,3-sialyltransferase; alpha2,3-sialyltransferase; alpha-2,3-sialyltransferase ST3Gal IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; CGS23; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; FLJ11867; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; Gal-NAc6S; glycosyltransferase; NANTA3; SAT3; SAT-3; sialyltransferase 4 C; sialyltransferase 4 C (beta-galactosidase alpha-2,3-sialytransferase); sialyltransferase 4 C (beta-galactoside alpha-2,3-sialytransferase); SIAT4; SIAT4C; SIAT4-C; ST3 beta-galactoside alpha-2,3-sialyltransferase 4; ST3Gal IV; ST3GAL4; ST3GalA0.2; ST3GalIV; ST3GAL-IV; ST-4; STZ
Common Name ST3GAL4
Gene Symbol St3gal4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less