missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101890

Invitrogen™ Human SSRP1 (aa 154-295) Control Fragment Recombinant Protein

Catalog No. RP101890
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101890 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101890 Supplier Invitrogen™ Supplier No. RP101890

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82030 (PA5-82030. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPT16 and SSRP1 are found in all eurkaryotic cells and exists as part of an essential heterodimer complex. Together, SPT 16 and SSRP1 are a highly abundant nuclear complex that in mammals has been called FACT, or Facilitates Chromatin Transcription. FACT enhances the processivity of RNA polymerase II through nucleosomes. Evidence also points to a role for FACT in replication, possibly by enhancing DNA polymerase through nucleosomes as well.

Specifications

Accession Number Q08945
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6749
Name Human SSRP1 (aa 154-295) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C81323; chromatin-specific transcription elongation factor 80 kDa subunit; Ciidbp; cisplatin-DNA SSRP; facilitates chromatin remodeling 80 kDa subunit; facilitates chromatin transcription complex 80 kDa subunit; Facilitates chromatin transcription complex subunit SSRP1; FACT; FACT 80 kDa subunit; FACT complex subunit SSRP1; FACT80; FACTp80; high mobility group box; Hmg1-rs1; Hmgi-rs3; Hmgox; hSSRP1; recombination signal sequence recognition protein 1; Ssrp1; structure specific recognition protein 1; structure-specific recognition protein 1; T160
Common Name SSRP1
Gene Symbol SSRP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less