missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96106

Invitrogen™ Human SSFA2 (aa 821-905) Control Fragment Recombinant Protein

Catalog No. RP96106
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96106 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96106 Supplier Invitrogen™ Supplier No. RP96106

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59021. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SSFA2 gene ontology annotations related to this gene include actin binding.

Specifications

Accession Number P28290
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6744
Name Human SSFA2 (aa 821-905) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 5730488C15Rik; cleavage signal-1 protein; CS1; CS-1; ITPRID2; ITPR-interacting domain-containing protein 2; KIAA1927; Ki-ras-induced actin-interacting protein; Krap; KRAS-induced actin-interacting protein; mKIAA1927; Protein ITPRID2; SPAG13; sperm associated antigen 13; sperm specific antigen 2; sperm-specific antigen 2; Sperm-specific antigen 2 homolog; SSFA2
Common Name SSFA2
Gene Symbol ITPRID2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less