missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SRC2 (aa 764-834) Control Fragment Recombinant Protein

Catalog No. RP106993
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106993 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106993 Supplier Invitrogen™ Supplier No. RP106993
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66314 (PA5-66314. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SRC2 (steroid receptor coactivator 2), also known as nuclear receptor coactivator2, NCOA2 or TIF2, aids in the function of nuclear hormone receptors. Nuclear hormone receptors are conditional transcription factors that play important roles in various aspects of cell growth, development, and homeostasis by controlling expression of specific genes. Members of the nuclear hormone receptor superfamily, which includes the 5 steroid receptors and class II nuclear receptors, are structurally characterized by 3 distinct domains: an N-terminal transcriptional activation domain, a central DNA-binding domain, and a C-terminal hormone-binding domain. Before the binding of hormone, steroid receptors, which are sometimes called class I of the nuclear hormone receptor family, remain inactive in a complex with heat-shock protein-90 and other stress family proteins. Binding of hormone induces critical conformational changes in steroid receptors that cause them to dissociate from the inhibitory complex, bind as homodimers to specific DNA enhancer elements associated with target genes, and modulate that gene's transcription. After binding to enhancer elements, transcription factors require transcriptional coactivator proteins to mediate their stimulation of transcription initiation.

Specifications

Accession Number Q15596
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10499
Name Human SRC2 (aa 764-834) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bHLHe75; c-fgr; Class E basic helix-loop-helix protein 75; c-src2; D1Ertd433e; FLJ43153; Glucocorticoid receptor-interacting protein 1; glucocorticoid receptor-interacting protein-1; Grip1; GRIP-1; hTIF2; I79_019839; KAT13C; MGC75096; NCOA2; NCoA-2; Nuclear receptor coactivator 2; p160 steroid receptor coactivator 2; p55c-fgr; p58c-fgr; SRC2; SRC-2; Steroid receptor coactivator 2; TIF 2; Tif2; transcriptional intermediary factor 2
Common Name SRC2
Gene Symbol NCOA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less