missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107061

Invitrogen™ Human SR140 (aa 435-516) Control Fragment Recombinant Protein

Catalog No. RP107061
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107061 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107061 Supplier Invitrogen™ Supplier No. RP107061

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66388 (PA5-66388. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

U2SURP (U2 SnRNP Associated SURP Domain Containing) is a Protein Coding gene. Diseases associated with U2SURP include Retinitis Pigmentosa 67. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and RNA binding. [GeneCards]

Specifications

Accession Number O15042
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23350
Name Human SR140 (aa 435-516) Control Fragment
Quantity 100 μL
Gene Alias 140 kDa Ser/Arg-rich domain protein; 2610101N10Rik; AU023006; fSAPa; functional spliceosome-associated protein a; KIAA0332; mp:zf637-1-000918; RGD1307882; Ser/Arg-rich domain protein, 140 kDa; si:dkey-181m9.9; SR140; U2 associated SR140 protein; U2 snRNP associated SURP domain containing; U2 snRNP-associated SURP domain containing; U2 snRNP-associated SURP motif-containing protein; U2-associated protein SR140; u2-associated protein SR140-like protein; U2-associated SR140 protein; U2SURP; wu:fa03e02; wu:fb38b01; wu:fc75d03
Common Name SR140
Gene Symbol U2SURP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less