missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97941

Invitrogen™ Human SPRYD7 (aa 99-180) Control Fragment Recombinant Protein

Catalog No. RP97941
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97941 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97941 Supplier Invitrogen™ Supplier No. RP97941

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60558. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C13orf1, also named as SPRYD7 and CLLD6, is involved in hematopoiesis via NOTCH signaling. C13orf1 plays an important role in the pathogenesis of B-CLL. There are isoforms of C13orf1 with MW 15-17 kDa and 19-22 kDa.

Specifications

Accession Number Q5W111
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 57213
Name Human SPRYD7 (aa 99-180) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 6330409N04Rik; C13orf1; Chronic lymphocytic leukemia deletion region gene 6 protein; chronic lymphocytic leukemia deletion region gene 6 protein homolog; CLL deletion region gene 6 protein; CLL deletion region gene 6 protein homolog; Clld6; PUR1; RGD1306437; SPRY domain containing 7; SPRY domain-containing protein 7; SPRYD7
Common Name SPRYD7
Gene Symbol Spryd7
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less