missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104041

Invitrogen™ Human Spectrin beta-4 (aa 2099-2196) Control Fragment Recombinant Protein

Catalog No. RP104041
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104041 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104041 Supplier Invitrogen™ Supplier No. RP104041

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62972 (PA5-62972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spectrin is the major constituent of the cytoskeletal network underlying the erthrocyte plasma membrane and determines cell shape, arrangement of transmembrane proteins and organization of organelles. It is expressed at very low levels in many tissues, with the strongest expression in the cerebellum, spinal cord, stomach, pituitary gland, liver, pancreas, salivary gland, kidney, bladder and heart. Spectrin beta 4 is a non-erythrocyte member, and is expressed in the brain and pancreatic islets and localisted to the nuclear matrix, cytoplasmic vesicles and PML nuclear bodies. Beta4 spectrins are also essential for membrane stability and the molecular organization of the nodes of Ranvier.

Specifications

Accession Number Q9H254
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57731
Name Human Spectrin beta-4 (aa 2099-2196) Control Fragment
Quantity 100 μL
Gene Alias 1700022P15Rik; 5830426A08Rik; beta-IV spectrin; beta-spectrin 4; dyn; EMBL BAB83243.1; KIAA1642; lnd; lumbosacral neuroaxonal dystrophy; neuroaxonal dystrophy; nmf261; nmf379; quivering; qv; ROSA62; SpbIV; spectrin beta 4; spectrin beta chain, brain 3; spectrin beta chain, non-erythrocytic 4; spectrin beta, non-erythrocytic 4; spectrin, beta, non-erythrocytic 4; spectrin, non-erythroid beta chain 3; SPNB4; SPTBN3; SPTBN4
Common Name Spectrin beta-4
Gene Symbol SPTBN4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less