missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104943

Invitrogen™ Human SPAG7 (aa 98-191) Control Fragment Recombinant Protein

Catalog No. RP104943
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104943 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104943 Supplier Invitrogen™ Supplier No. RP104943

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65719 (PA5-65719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPAG7 gene ontology annotations related to this gene include nucleic acid binding.

Specifications

Accession Number O75391
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9552
Name Human SPAG7 (aa 98-191) Control Fragment
Quantity 100 μL
Gene Alias 5730443G10; ACRP; FSA-1; Fsa1l; hypothetical protein LOC515086; similar to sperm associated antigen 7; SPAG7; sperm associated antigen 7; sperm-associated antigen 7; Sperm-associated antigen 7 homolog; zgc:66397
Common Name SPAG7
Gene Symbol SPAG7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less