Learn More
Invitrogen™ Human SNTG2 (aa 256-324) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109083
Description
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139874 (PA5-139874, PA5-140012 (PA5-140012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Syntrophin gamma 2 encodes a protein belonging to the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that bind to components of mechanosenstive sodium channels and the extreme carboxy-terminal domain of dystrophin and dystrophin-related proteins. The PDZ domain of this protein product interacts with a protein component of a mechanosensitive sodium channel that affects channel gating. Absence or reduction of this protein product has been associated with Duchenne muscular dystrophy. There is evidence of alternative splicing yet the full-length nature of these variants has not been described.Specifications
| Q9NY99 | |
| Blocking Assay, Control | |
| 54221 | |
| 100 μL | |
| 2210008K22Rik; 9530013L23; BB121248; G2SYN; Gamma-2-syntrophin; gamma2-syntrophin; MGC133174; SNTG2; SYN5; syntrophin; syntrophin 5; syntrophin gamma 2; syntrophin, gamma 2; syntrophin-5 | |
| SNTG2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SNTG2 (aa 256-324) Control Fragment | |
| RUO | |
| SNTG2 | |
| Unconjugated | |
| Recombinant | |
| ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |