missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94001

Invitrogen™ Human SNRNP40 (aa 278-357) Control Fragment Recombinant Protein

Catalog No. RP94001
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94001 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94001 Supplier Invitrogen™ Supplier No. RP94001

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55331 (PA5-55331. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs.

Specifications

Accession Number Q96DI7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9410
Name Human SNRNP40 (aa 278-357) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610009C03Rik; 38 kDa-splicing factor; 40 K; HPRP8BP; Prp8-binding protein; Prp8bp; PRPF8BP; RGD1309198; RP11-490K7.3; SFP38; small nuclear ribonucleoprotein 40 (U5); small nuclear ribonucleoprotein 40 kDa (U5); small nuclear ribonucleoprotein U5 subunit 40; small nuclear ribonucleoprotein, U5 40 kDa subunit; Snrnp40; SPF38; U5 small nuclear ribonucleoprotein 40 kDa protein; U5 snRNP 40 kDa protein; U5 snRNP-specific 40 kDa protein; U5 snRNP-specific 40 kDa protein (hPrp8-binding); U5 snRNP-specific protein (Prp8-binding); U5-40 K; U5-40 kD protein; WD repeat domain 57 (U5 snRNP specific); WD repeat-containing protein 57; Wdr57
Common Name SNRNP40
Gene Symbol SNRNP40
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less