missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94945

Invitrogen™ Human SNR48 (aa 15-106) Control Fragment Recombinant Protein

Catalog No. RP94945
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94945 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94945 Supplier Invitrogen™ Supplier No. RP94945
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56086 (PA5-56086. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q6IEG0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 154007
Name Human SNR48 (aa 15-106) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110050F08Rik; 6530403A03Rik; C6orf151; dJ336K20B0.1; dJ512B11.2; RGD1309020; small nuclear ribonucleoprotein 48 (U11/U12); small nuclear ribonucleoprotein 48 k (U11/U12); small nuclear ribonucleoprotein 48 kDa (U11/U12); small nuclear ribonucleoprotein U11/U12 subunit 48; small nuclear ribonucleoprotein, U11/U12 48 KDa subunit; Snrnp48; U11/U12 small nuclear ribonucleoprotein 48 kDa protein; U11/U12 snRNP 48 kDa protein; U11/U12 snRNP 48 K; U11/U12-48 K
Common Name SNR48
Gene Symbol Snrnp48
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less