missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96166

Invitrogen™ Human SNED1 (aa 1037-1120) Control Fragment Recombinant Protein

Catalog No. RP96166
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96166 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96166 Supplier Invitrogen™ Supplier No. RP96166

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57648 (PA5-57648. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNED1 (Sushi, Nidogen And EGF Like Domains 1) is a Protein Coding gene. Diseases associated with SNED1 include Cortical Thymoma and Hyperpituitarism. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is NOTCH1. [GeneCards]

Specifications

Accession Number Q8TER0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25992
Name Human SNED1 (aa 1037-1120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6720455I24Rik; 6720455I24Rik homolog; AI197264; AI642697; D430044C15Rik; insulin responsive sequence DNA binding protein-1; insulin-responsive sequence DNA-binding protein 1; IRE-BP1; secreted nidogen domain protein; secreted protein SST3; secreted protein SST-3; Sned1; Snep; SST3; Stromal nidogen extracellular matrix protein; sushi, nidogen and EGF like domains 1; sushi, nidogen and EGF-like domain-containing protein 1; sushi, nidogen and EGF-like domains 1
Common Name SNED1
Gene Symbol SNED1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTLSGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less