missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108688

Invitrogen™ Human SNAPC2 (aa 174-234) Control Fragment Recombinant Protein

Catalog No. RP108688
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108688 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108688 Supplier Invitrogen™ Supplier No. RP108688
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the snRNA-activating protein complex which is associated with the TATA box-binding protein. The encoded protein is necessary for RNA polymerase II and III dependent small-nuclear RNA gene transcription. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q13487
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6618
Name Human SNAPC2 (aa 174-234) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610007H10Rik; AU015675; Proximal sequence element-binding transcription factor subunit delta; PSE-binding factor subunit delta; PTF subunit delta; PTFDELTA; small nuclear RNA activating complex polypeptide 2; small nuclear RNA activating complex, polypeptide 2; small nuclear RNA activating complex, polypeptide 2, 45 kD; small nuclear RNA activating complex, polypeptide 2, 45 kDa; small nuclear RNA-activating complex polypeptide 2; SNAP45; SNAPc 45 kDa subunit; SNAPc subunit 2; SNAPC2; snRNA-activating protein complex 45 kDa subunit; snRNA-activating protein complex subunit 2
Common Name SNAPC2
Gene Symbol SNAPC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less