missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92005

Invitrogen™ Human SMEK2 Control Fragment Recombinant Protein

Catalog No. RP92005
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92005 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92005 Supplier Invitrogen™ Supplier No. RP92005

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51545 (PA5-51545. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers. [UniProt]

Specifications

Accession Number Q5MIZ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57223
Name Human SMEK2 Control Fragment
Quantity 100 μL
Gene Alias AW011752; AW557776; FLFL2; KIAA1387; mKIAA1387; Pp4r3b; PPP4R3B; protein phosphatase 4 regulatory subunit 3 B; protein phosphatase 4, regulatory subunit 3 B; PSY2; RGD1309450; Serine/threonine-protein phosphatase 4 regulatory subunit 3 B; SMEK homolog 2; SMEK homolog 2, suppressor of mek1; SMEK homolog 2, suppressor of mek1 (Dictyostelium); SMEK2; smk1
Common Name SMEK2
Gene Symbol PPP4R3B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less