missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC6A7 (aa 560-629) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP110152
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144911 (PA5-144911. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is a member of the gamma-aminobutyric acid (GABA) neurotransmitter gene family and encodes a high-affinity mammalian brain L-proline transporter protein. This transporter protein differs from other sodium-dependent plasma membrane carriers by its pharmacological specificity, kinetic properties, and ionic requirements.Specifications
| Q99884 | |
| Blocking Assay, Control | |
| 6534 | |
| 100 μL | |
| AW455934; brain-specific L-proline transporter; L-proline transporter; proline transporter; Prot; Slc6a7; sodium-dependent proline transporter; solute carrier family 6 (neurotransmitter transporter), member 7; solute carrier family 6 (neurotransmitter transporter, L-proline), member 7; solute carrier family 6 member 7 | |
| SLC6A7 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SLC6A7 (aa 560-629) Control Fragment | |
| RUO | |
| SLC6A7 | |
| Unconjugated | |
| Recombinant | |
| REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |