missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89587

Invitrogen™ Human SLC6A17 (aa 639-727) Control Fragment Recombinant Protein

Catalog No. RP89587
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89587 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89587 Supplier Invitrogen™ Supplier No. RP89587

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139729 (PA5-139729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functions as a sodium-dependent vesicular transporter selective for proline, glycine, leucine and alanine. In contrast to other members of this neurotransmitter transporter family, does not appear to be chloride-dependent.

Specifications

Accession Number Q9H1V8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 388662
Name Human SLC6A17 (aa 639-727) Control Fragment
Quantity 100 μL
Gene Alias D130012J15Rik; MRT48; Ntt4; orphan sodium- and chloride-dependent neurotransmitter transporter NTT4; Rxt1; Slc6a17; Sodium-dependent neurotransmitter transporter NTT4; sodium-dependent neutral amino acid transporter SLC6A17; sodium-dependent orphan neurotramsmitter transporter NTT4; solute carrier family 6 (neurotransmitter transporter), member 17; solute carrier family 6 (neutral amino acid transporter), member 17; solute carrier family 6 member 17; solute carrier family 6, member 17
Common Name SLC6A17
Gene Symbol SLC6A17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less