missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC51B (aa 77-127) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP88590
Description
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52574 (PA5-52574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The heteromeric transporter OST Alpha/OST Beta facilitates the transport of bile and other steroid solutes across the basolateral epithelial cell membrane of intestine, liver, testis, kidney and adrenal gland. OST Alpha/OST Beta expression is induced by bile acids through ligand-dependent transactivation of their genes by FXR (Farnesoid X-activated receptor). This genetic regulation suggests that in response to changes in intracellular bile acid levels, bile acids adjust the rate of their own efflux from enterocytes. OST Beta is a 128 amino acid single-pass transmembrane protein that requires OST Alpha to localize to the plasma membrane. Coexpression of OST Alpha and OST Beta is also required to convert the OST Alpha subunit to a mature glycosylated endoglycosidase H-resistant form, suggesting that co-expression facilitates trafficking of OST Alpha through the golgi apparatus. Though widely expressed, OST Beta is present at highest levels in ileum.Specifications
| Q86UW2 | |
| Blocking Assay, Control | |
| 123264 | |
| 100 μL | |
| organic solute transporter beta; organic solute transporter beta subunit; organic solute transporter subunit beta; Ost beta; Ostb; Ostbeta; OST-beta; RGD1565748; Slc51b; solute carrier family 51 beta subunit; solute carrier family 51 subunit beta; solute carrier family 51, beta subunit | |
| SLC51B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SLC51B (aa 77-127) Control Fragment | |
| RUO | |
| SLC51B | |
| Unconjugated | |
| Recombinant | |
| VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |