missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC4A9 (aa 140-215) Control Fragment Recombinant Protein

Catalog No. RP101214
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101214 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101214 Supplier Invitrogen™ Supplier No. RP101214

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62377 (PA5-62377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC4A9 Probable apical anion exchanger of the kidney cortex. Belongs to the anion exchanger (TC 2.A.31) family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass. Cellular Component: apical part of cell; plasma membrane; integral to membrane. Molecular Function: inorganic anion exchanger activity. Biological Process: bicarbonate transport; ion transport; transmembrane transport.

Specifications

Accession Number Q96Q91
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83697
Name Human SLC4A9 (aa 140-215) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AE 4; AE4; Anion exchange protein 4; anion exchanger 4; D630003B07; D630024F24Rik; SBC5; SLC4A9; Sodium bicarbonate cotransporter 5; solute carrier family 4 member 9; solute carrier family 4, sodium bicarbonate cotransporter, member 9
Common Name SLC4A9
Gene Symbol SLC4A9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQHYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less