missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91073

Invitrogen™ Human SLC4A11 (aa 78-178) Control Fragment Recombinant Protein

Catalog No. RP91073
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91073 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91073 Supplier Invitrogen™ Supplier No. RP91073

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53730 (PA5-53730. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described.

Specifications

Accession Number Q8NBS3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83959
Name Human SLC4A11 (aa 78-178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI503023; bicarbonate transporter related protein 1; bicarbonate transporter-related protein 1; BTR1; CDPD; CDPD1; CHED; CHED2; dJ794I6.2; MGC126418; MGC126419; NABC1; OTTHUMP00000030097; Slc4a11; Sodium bicarbonate transporter-like protein 11; Sodium borate cotransporter 1; sodium-coupled borate cotransporter 1; solute carrier family 4 member 11; solute carrier family 4, sodium bicarbonate transporter-like, member 11; solute carrier family 4, sodium borate transporter, member 11
Common Name SLC4A11
Gene Symbol SLC4A11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less