missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91142

Invitrogen™ Human SLC35A3 (aa 2-44) Control Fragment Recombinant Protein

Catalog No. RP91142
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91142 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91142 Supplier Invitrogen™ Supplier No. RP91142
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53292 (PA5-53292. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter in the Golgi apparatus. May supply UDP-GlcNAc as substrate for Golgi-resident glycosyltransferases that generate branching of diantennary oligosaccharides.

Specifications

Accession Number Q9Y2D2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23443
Name Human SLC35A3 (aa 2-44) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AMRS; golgi UDP-GlcNAc transporter; Slc35a3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3; solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3; solute carrier family 35 member 3; solute carrier family 35 member 3 A; solute carrier family 35 member A3; UDP N-acetylglucosamine transporter; UDP-N-acetylglucosamine transporter
Common Name SLC35A3
Gene Symbol SLC35A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTMF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less