missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC2A12 (aa 219-278) Control Fragment Recombinant Protein

Catalog No. RP94897
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94897 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94897 Supplier Invitrogen™ Supplier No. RP94897

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56789. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Solute carrier family 2, facilitated glucose transporter member 12 is a protein that in humans is encoded by the SLC2A12 gene. SLC2A12 belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion. This family of transporters show conservation of 12 transmembrane helices as well as functionally significant amino acid residues.

Specifications

Accession Number Q8TD20
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 154091
Name Human SLC2A12 (aa 219-278) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias facilitated glucose transporter; glucose transporter type 12; GLUT12; GLUT-12; GLUT8; SLC2A12; solute carrier family 2 (facilitated glucose transporter), member 12; solute carrier family 2 member 12; solute carrier family 2, facilitated glucose transporter member 12; solute carrier family 2, member 12
Common Name GLUT12
Gene Symbol SLC2A12
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less