missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90992

Invitrogen™ Human SLC25A31 (aa 148-201) Control Fragment Recombinant Protein

Catalog No. RP90992
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90992 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90992 Supplier Invitrogen™ Supplier No. RP90992
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82520 (PA5-82520. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchange of ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by most energy-consuming reactions.

Specifications

Accession Number Q9H0C2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83447
Name Human SLC25A31 (aa 148-201) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700034J06Rik; Aac4; adenine nucleotide translocase 4; adenine nucleotide translocator 4; adenine nucleotide translocator), member 31; adenine nucleotide translocator), member 31-like; ADP,ATP carrier protein 4; ADP/ATP translocase 4; ANT 4; Ant4; LOC541168 protein; Sfec; SFEC35kDa; SLC25A31; solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 31-like; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31; solute carrier family 25 member 31; Sperm flagellar energy carrier protein
Common Name SLC25A31
Gene Symbol SLC25A31
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less