missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107818

Invitrogen™ Human SLC22A18 (aa 203-243) Control Fragment Recombinant Protein

Catalog No. RP107818
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107818 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107818 Supplier Invitrogen™ Supplier No. RP107818

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67175 (PA5-67175. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ORCTL2 (organic cation transporter-like protein 2), also known as HET, ITM, BWR1A, IMPT1, TSSC5, BWSCR1A, SLC22A1L, p45-BWR1A or SLC22A18, is a 424 amino acid multi-pass membrane protein that localizes at the apical membrane surface of renal proximal tubules. ORCTL2 is expressed at high levels in the kidney, liver, colon and in fetal renal proximal tubules and present at lower levels in heart, brain and lung. Belonging to the major facilitator superfamily, ORCTL2 may act as a transporter of organic cations based on a proton efflux antiport mechanism and may also play a role in the transport of chloroquine and quinidine-related compounds in kidney. Defects in ORCTL2 are associated with breast and lung cancer and are the cause of rhabdomyosarcoma type 1, a malignant tumor derived from striated muscle.

Specifications

Accession Number Q96BI1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5002
Name Human SLC22A18 (aa 203-243) Control Fragment
Quantity 100 μL
Gene Alias AW260131; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein; BWR1A; BWSCR1A; Efflux transporter-like protein; HET; imprinted multi-membrane spanning polyspecific transporter-related protein 1; imprinted multi-membrane-spanning polyspecific transporter-related protein 1; Impt1; ITM; Multi-membrane-spanning polyspecific transporter; ORCTL2; ORCTL-2; Organic cation transporter-like protein 2; organic cationic transporter-like 2; p45 Beckwith-Wiedemann region 1 A; p45-Beckwith-Wiedemann region 1 A; p45-BWR1A; SLC22A18; SLC22A1L; solute carrier family 22 (organic cation transporter), member 18; Solute carrier family 22 member 18; Solute carrier family 22 member 1-like; solute carrier family 22, member 18; TSSC5; tumor suppressing subtransferable candidate 5; tumor-suppressing STF cDNA 5 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein
Common Name SLC22A18
Gene Symbol SLC22A18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less