missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101189

Invitrogen™ Human SLC16A6 (aa 208-284) Control Fragment Recombinant Protein

Catalog No. RP101189
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101189 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101189 Supplier Invitrogen™ Supplier No. RP101189
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62970 (PA5-62970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Specifications

Accession Number O15403
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9120
Name Human SLC16A6 (aa 208-284) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW743111; breast cancer protein BCY5; EGK_08910; ESTM12; MCT 6; MCT 7; MCT6; MCT7; Mct7B; monocarboxylate transporter; Monocarboxylate transporter 6; monocarboxylate transporter 7; monocarboxylate transporter 7 B; monocarboxylate transporter 7-like; MOT7; Slc16a6; solute carrier family 16 (monocarboxylic acid transporters), member 6; solute carrier family 16 member 6; solute carrier family 16, member 6; solute carrier family 16, member 6 (monocarboxylic acid transporter 7)
Common Name SLC16A6
Gene Symbol SLC16A6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less