missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91205

Invitrogen™ Human SLC13A2 (aa 143-261) Control Fragment Recombinant Protein

Catalog No. RP91205
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91205 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91205 Supplier Invitrogen™ Supplier No. RP91205
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53262 (PA5-53262. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC13A2 belongs to the SLC13A transporter (TC 2.A.47) family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Specifications

Accession Number Q13183
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9058
Name Human SLC13A2 (aa 143-261) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hypothetical protein LOC505069; INDY; intestinal sodium/dicarboxylate cotransporter; mNaDC-1; mucin; Na(+)/dicarboxylate cotransporter 1; Na(+)-coupled citrate transporter; NaCT; Nadc1; naDC-1; Renal sodium/dicarboxylate cotransporter; SDCT1; Slc13a2; sodium/dicarboxylate cotransporter; sodium/dicarboxylate co-transporter; sodium-dependent dicarboxylate transporter; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2; solute carrier family 13 member 2; solute carrier family 13, member 2
Common Name SLC13A2
Gene Symbol SLC13A2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less