missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90817

Invitrogen™ Human SLBP (aa 15-110) Control Fragment Recombinant Protein

Numéro de catalogue. RP90817
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP90817 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP90817 Fournisseur Invitrogen™ Code fournisseur RP90817
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53966 (PA5-53966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Spécifications

Accession Number Q14493
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7884
Name Human SLBP (aa 15-110) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cb157; ele; hairpin binding protein, histone; HBP; histone binding protein; histone RNA hairpin-binding protein; histone stem loop binding protein; histone stem-loop binding protein; histone stem-loop-binding protein; RNA binding protein; sb:cb157; si:dkey-102m7.2; SLBP; Slbp protein; stem-loop (histone) binding protein; stem-loop binding protein; Unknown (protein for MGC:134385)
Common Name SLBP
Gene Symbol SLBP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats