missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91735

Invitrogen™ Human SIRT5 (aa 142-222) Control Fragment Recombinant Protein

Catalog No. RP91735
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91735 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91735 Supplier Invitrogen™ Supplier No. RP91735
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110876 (PA5-110876. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIRT5 is a human member of a family of proteins called Sirtuins (Sir2-like proteins) and are present in prokaryotes and eukaryotes. All Sir2-like proteins have a sirtuin core domain, which contains a series of sequence motifs conserved in organisms ranging from bacteria to humans. Bacterial, yeast and mammalian sirtuins are able to metabolize NAD and possibly at as mono-ADP-ribosyltransferases. The enzymatic function of sirtuins is not yet completely understood but recent reports of histone-activated Sir2-mediated NAD metabolism and NAD-activated Sir2-mediated histone deacetylation suggest a possible coupled reciprocal activation mechanism involving interactions of Sir2 with NAD and the N epsilon-acetyl-lysine groups of acetylated histones.

Specifications

Accession Number Q9NXA8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23408
Name Human SIRT5 (aa 142-222) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610012J09Rik; 1500032M05Rik; AV001953; FLJ36950; HAMAP-Rule:MF_03160}; hypothetical protein LOC507347; NAD-dependent deacetylase sirtuin-5; NAD-dependent deacetylase sirtuin-5-like protein; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; NAD-dependent protein deacylase sirtuin-5, mitochondrial; NAD-dependent protein deacylase sirtuin-5, mitochondrial {ECO:0000255; Regulatory protein SIR2 homolog 5; regulatory protein SIR2 homolog 5 {ECO:0000255; si:ch211-121a2.1; silent mating type information regulation 2, S.cerevisiae, homolog 5; Sir2l5; sir2-like 5; SIR2-like protein 5; SIR2-like protein 5 {ECO:0000255; Sirt5; sirtuin; sirtuin 5; sirtuin type 5; zgc:92288
Common Name SIRT5
Gene Symbol SIRT5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less