missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90607

Invitrogen™ Human SIGLEC14 (aa 213-332) Control Fragment Recombinant Protein

Catalog No. RP90607
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90607 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90607 Supplier Invitrogen™ Supplier No. RP90607

Please call Customer Service at 1-800-234-7437 or send an email to help@thermofisher.com for assistance.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative adhesion molecule. Sialic acid-binding paired receptor which may activate associated receptors. Interacts with TYROBP. Mainly expressed in hematopoietic tissues including bone marrow, spleen and fetal liver. Siglec-14 is predominantly expressed in hematopoietic tissues but is also found in lung and testis.

Specifications

Accession Number Q08ET2
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 100049587
Name Human SIGLEC14 (aa 213-332) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias LLNLR-470E3.1; sialic acid binding Ig like lectin 14; sialic acid binding Ig-like lectin 14; sialic acid-binding Ig-like lectin 14; SIG14; Siglec; SIGLEC14; Siglec-14; UNQ294; UNQ294/PRO333
Common Name SIGLEC14
Gene Symbol SIGLEC14
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNPPASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less