Learn More
Invitrogen™ Human SIGLEC11 (aa 668-698) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101402
Description
Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139815 (PA5-139815, PA5-63831 (PA5-63831. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Siglecs are sialic acid-binding lectins of the immunoglobulin superfamily that are mainly expressed in cells of the hematopoietic system. Siglec11 is unlike other siglecs in that it binds specifically to alpha2-8-linked sialic acids and is not found in peripheral blood leukocytes but instead on macrophages of various tissues. Siglec11 is highly homologous to Siglec10 over their extracellular domain but not over their cytoplasmic domain, suggesting that Siglec11 arose through gene duplication followed by a recombination event involving another ancestral siglec gene. Following treatment of Siglec11-transfected cells with pervanadate, Siglec11 becomes tyrosine-phosphorylated and strongly associates with SHP-1 and SHP-2. At least five isoforms of Siglec11 are known to exist.Specifications
| Q96RL6 | |
| Blocking Assay, Control | |
| 114132 | |
| 100 μL | |
| sialic acid binding Ig like lectin 11; sialic acid binding Ig-like lectin 11; sialic acid-binding Ig-like lectin 11; Sialic acid-binding lectin 11; Siglec; SIGLEC11; siglec-11; UNQ9222/PRO28718 | |
| SIGLEC11 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SIGLEC11 (aa 668-698) Control Fragment | |
| RUO | |
| SIGLEC11 | |
| Unconjugated | |
| Recombinant | |
| YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |