missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97509

Invitrogen™ Human SI-CLP (aa 32-109) Control Fragment Recombinant Protein

Catalog No. RP97509
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97509 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97509 Supplier Invitrogen™ Supplier No. RP97509

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58761 (PA5-58761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SI-CLP detects human Stabilin-interacting chitinase like protein (SI-CLP), a novel member of the Glyco-18-domain containing protein family. SI-CLP is a secretory protein which is up-regulated in response to interleukin-4 and dexamethasone in activated macrophages. SI-CLP is also expressed by T- and B-lymphocytes, and by cells of monocytic and epithelial origin. SI-CLP is the ligand for stabilin-1, an intracellular sorting receptor which sorts SI-CLP into late endosomes and secretory lysosomes in activated macrophages.

Specifications

Accession Number Q9BWS9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 66005
Name Human SI-CLP (aa 32-109) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110023E09Rik; AI841869; CHID1; chitinase domain containing 1; chitinase domain-containing protein 1; FLJ42707; GL008; MGC3234; PSEC0104; SB139; SICLP; SI-CLP; stabilin-1 interacting chitinase-like protein; stabilin-1-interacting chitinase-like protein
Common Name SI-CLP
Gene Symbol CHID1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less